PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G29490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 225aa    MW: 25074.4 Da    PI: 6.6235
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G29490.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.97.1e-1170119150
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                      e++l+++r+   NReA r++R++Kka  + Lee+vk+L + N++L  +l+
  LPERR01G29490.1  70 EEDLRKTRKPLGNREAVRKYREKKKAHAAFLEEEVKKLRTTNQQLLRRLQ 119
                      789******************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.7E-1570138No hitNo description
SMARTSM003381.9E-1270137IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.03672119IPR004827Basic-leucine zipper domain
PfamPF077164.3E-1272119IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.38E-873120No hitNo description
CDDcd146861.32E-1175128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MDDELHLPIP SHLLFSHPEI SHGFDELLKN TTTCTHSHTC NAPGPSVAMH THTCLHTHIQ  60
VIASGENNVE EDLRKTRKPL GNREAVRKYR EKKKAHAAFL EEEVKKLRTT NQQLLRRLQG  120
HISLEAEVVR LRALLFDIRG KIDAEIGTFP FQKQCSFGSV TCTDHSPCFN TNAEVAVRED  180
SSRPTIVNGV IGETGIISHE LDIPEMANSV DVIPSFVNSA SLLTE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0032210.0AP003221.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0003D09.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618027.11e-143PREDICTED: uncharacterized protein LOC107278258
RefseqXP_015618034.11e-143PREDICTED: uncharacterized protein LOC107278258
SwissprotQ8GTS24e-50BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A0D9V6U11e-167A0A0D9V6U1_9ORYZ; Uncharacterized protein
STRINGOB01G42980.11e-138(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.15e-34bZIP family protein